Protein Info for TX73_004740 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter transmembrane domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 75 to 96 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 335 to 343 (9 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 57 to 631 (575 residues), 908.3 bits, see alignment E=1.1e-277 PF00664: ABC_membrane" amino acids 77 to 339 (263 residues), 180.2 bits, see alignment E=7.1e-57 PF00005: ABC_tran" amino acids 411 to 560 (150 residues), 120.7 bits, see alignment E=7.7e-39

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rpa:RPA0919)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase and permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (634 amino acids)

>TX73_004740 ABC transporter transmembrane domain-containing protein (Rhodopseudomonas palustris CGA009)
MTAPNKPQSSNSDASAISLSLDAIAATENVGPRTGTLRADADPSQVEEVAAVVKRSRLKP
LLSLMPYVARYRGRATLALIALIVAAATTLVVPVAVRRLIDFGFSAEGVELINGYFSVML
GVVVVLAAASAARYYLVMTIGERIVADVRRDVFRHLTALSPAFFDSARSGELISRLTADT
TQIKSAVGASVSIALRNMLLFVGAISMMVISSPRLSGFVLAAIPLIVIPLVAFGRWVRRL
SRNAQDTLADASAYAAELVGAIRTVQAYTNERVANARFGGAVEESYEAARSSTGARALLT
AIIIFIVFASVVAILWVGSHDVAIGAMSPGRLGQFILYAVFAASSLGQLSEVWGEVSAAS
GAAERLFEILRVKPEIAAPAKPKALPMPVRGDVLFDNVSFSYPTRPDFLALDGLSLSIKA
GEKVAIVGPSGAGKSTLFHLLLRFYDPTSGTIALDGVAINAADPQAVRERIALVPQDSVV
FAATARDNISFGRDDASELDVERAAQQAHATEFISRLPEGFDTKLGERGVTLSGGQRQRI
AIARAILRDAPLLLLDEATSSLDAESEVLVQTALQQLMRDRTTLVIAHRLATVLSCDRIV
VMEHGRIVEQGTHAQLVARGGLYARLAKLQFEAA