Protein Info for TX73_004630 in Rhodopseudomonas palustris CGA009

Annotation: lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 344 to 358 (15 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 90 to 386 (297 residues), 345.9 bits, see alignment E=9.6e-108 PF13406: SLT_2" amino acids 91 to 382 (292 residues), 352.2 bits, see alignment E=3.4e-109 PF08823: PG_binding_2" amino acids 390 to 440 (51 residues), 28.4 bits, see alignment 2.5e-10 PF01471: PG_binding_1" amino acids 407 to 458 (52 residues), 48.9 bits, see alignment 9.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_0968)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>TX73_004630 lytic murein transglycosylase (Rhodopseudomonas palustris CGA009)
MTGHNRLAAAALAAWFGGVALSATAAQAQSGNPLNFLDSIFGNPSPSRPAAPGAGAPSGG
SSAVQPWSGEDGASGHPLMTAAAIREAAANFDNCVAAMWPDAARRGISRESFERYTAGLS
PDLRLMDLMDSQPEFTKSIWDYLDILVNDTRLAKGREILAQYKPQFDAVERAYGVDRYII
ASIWGIESNYSTQMGDRYVVNSTATLACVGRRQAYFKDEFLTALEILHRGDLRPEQLRGS
WAGAFGPTQFMPTAFKRFAVDADGDGRRDVVDNPYDLIASTANNLKKDGWQTGQTWGYEV
VVPRGFNYMLADRRQTQTLAQWEQMGLRRAGGQPFPRSNEKAYLLAPAGAAGPGFLMLTN
FRVIMKYNPAEAYALAIGHFADRLRGGAPFVQEWPRQERALSRTEKLELQQLLAQRGFYR
GTPDGQFGSETRSALRNFQASIGAPADGFATGEMLERLRGR