Protein Info for TX73_004530 in Rhodopseudomonas palustris CGA009

Annotation: KpsF/GutQ family sugar-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF01380: SIS" amino acids 57 to 189 (133 residues), 96.9 bits, see alignment E=8.5e-32 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 62 to 327 (266 residues), 306.2 bits, see alignment E=1.2e-95 PF00571: CBS" amino acids 233 to 273 (41 residues), 23.6 bits, see alignment 5.3e-09 amino acids 282 to 334 (53 residues), 40.7 bits, see alignment 2.4e-14

Best Hits

Swiss-Prot: 49% identical to KDSD_PSEAE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to rpa:RPA0879)

MetaCyc: 50% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Polysialic acid capsule sugar isomerase, KpsF/GutQ family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>TX73_004530 KpsF/GutQ family sugar-phosphate isomerase (Rhodopseudomonas palustris CGA009)
MALSKNHTKTPTMSEQAAAAIPSALRTLEAEASGVTALATALQSDLGVRFAATIDLIQNA
KGRLIITGLGKSGHIGRKIAATFASTGTPAFFVHASEASHGDLGMITADDIILAMSWSGE
QPEMKNLINYAKRFKIALVAMTSDSTSTLATAADVSLTLPKAREACPHNLAPTTSSLMML
ALGDALAIALLESRGFTPGDFSVLHPGGKLGAMLKYARDLMHTGEAIPLKPLGTRMSDAL
VEMSAKGFGCVGIIDSNGQIAGIVTDGDLRRNMRSDLMTATVDEVMTRNPKTISPNLLAG
QALELLNSSKITALLVAEGKKPLGIVHLHDLLRAGVA