Protein Info for TX73_004360 in Rhodopseudomonas palustris CGA009

Annotation: F0F1 ATP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 5 to 244 (240 residues), 226.8 bits, see alignment E=1.6e-71 PF00119: ATP-synt_A" amino acids 33 to 241 (209 residues), 213.9 bits, see alignment E=1.3e-67

Best Hits

Swiss-Prot: 100% identical to ATP6_RHOPA: ATP synthase subunit a (atpB) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to rpx:Rpdx1_1013)

Predicted SEED Role

"ATP synthase F0 sector subunit a"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>TX73_004360 F0F1 ATP synthase subunit A (Rhodopseudomonas palustris CGA009)
MAADPIHQFQITKLFTLGHVGGQEIAFTNSSAYMFGTVALIAILMLVPGRQLVPGRLQSI
AELSYEFVANMIRSTAGKEGLKFFPLVFSLFMFIAVSNLIGIVPYTFTVSSHLIVTVALA
LLVFFTVLIYGFSKNGLKFFKLFVPSGVPIYILPLVVFIEVISFFLKPVSHSVRLFANML
AGHIALKVFASFVAMLGALGVVGWFGAVLPLGLTIALTALELLVAFLQAYVFAILTCIYL
NDAIHPGH