Protein Info for TX73_004185 in Rhodopseudomonas palustris CGA009

Annotation: TIGR02186 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 242 to 263 (22 residues), see Phobius details TIGR02186: conserved hypothetical protein" amino acids 12 to 266 (255 residues), 330.9 bits, see alignment E=2.3e-103 PF09608: Alph_Pro_TM" amino acids 33 to 265 (233 residues), 272.8 bits, see alignment E=1.4e-85

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_0880)

Predicted SEED Role

"putative transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>TX73_004185 TIGR02186 family protein (Rhodopseudomonas palustris CGA009)
MMARRLTSLRAIATAGLLALMLPFAAPADAERLIVSVSNARVTVTPNYSGGELVLFGAIE
KDHPAFVEAGKYDLVISVFGPRANMVTRRKERKFGIWINSDSREFLMVPSYLAIFANRPI
DAIAPTEVRRRQQLGMNHVLLTQRIGTDYADVVADDQFRQAFIRLREDRGLYREDTTAVK
FLTPTLFRTGIPLPAEVPIGSYDISIKLFASGELLTETDTSFEIAKIGFEQFVATAARQH
GIIYGLITALMALATGWMASIVFRRD