Protein Info for TX73_003800 in Rhodopseudomonas palustris CGA009

Annotation: formate dehydrogenase accessory sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 219 to 235 (17 residues), see Phobius details TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 28 to 265 (238 residues), 201.1 bits, see alignment E=8.7e-64 PF02634: FdhD-NarQ" amino acids 28 to 264 (237 residues), 261.8 bits, see alignment E=3.4e-82

Best Hits

Swiss-Prot: 53% identical to FDHD_BRUAB: Sulfur carrier protein FdhD (fdhD) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to rpa:RPA0735)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>TX73_003800 formate dehydrogenase accessory sulfurtransferase FdhD (Rhodopseudomonas palustris CGA009)
MARRTVHTGKTRVWRHGRMQAGTRAIPDETPVAISYNGSSQAVMMATPADLEDFAIGFSL
SEGVIGQAAEIDSLEIVPHDDGVELRMWLAGDVAERLQQRRRHIAGPTGCGLCGVDSIAE
AVRPVATVGAGRSFSPQQIIAAIEALPPLQKLNVETRAVHAAAYFTPEQGIQHVREDVGR
HNALDKLVGALARDRIDAANGIVLLTSRVSVEMVQKTAAIGAAVLVAVSAPTALAVRMAE
AAGITLAAIARSDGFEIFTHPQRIVEIDHKGAADVA