Protein Info for TX73_003480 in Rhodopseudomonas palustris CGA009

Annotation: 4-hydroxybenzoyl-CoA reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR03195: 4-hydroxybenzoyl-CoA reductase, beta subunit" amino acids 3 to 321 (319 residues), 561.7 bits, see alignment E=2.2e-173 PF00941: FAD_binding_5" amino acids 7 to 214 (208 residues), 153 bits, see alignment E=7.3e-49 PF03450: CO_deh_flav_C" amino acids 221 to 319 (99 residues), 36 bits, see alignment E=6.7e-13

Best Hits

Swiss-Prot: 48% identical to HCRB_THAAR: 4-hydroxybenzoyl-CoA reductase subunit beta (hcrB) from Thauera aromatica

KEGG orthology group: K04109, 4-hydroxybenzoyl-CoA reductase subunit beta [EC: 1.3.7.9] (inferred from 100% identity to rpa:RPA0672)

MetaCyc: 100% identical to 4-hydroxybenzoyl-CoA reductase HbaD subunit (Rhodopseudomonas palustris CGA009)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.7.9

Use Curated BLAST to search for 1.1.7.1 or 1.3.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>TX73_003480 4-hydroxybenzoyl-CoA reductase subunit beta (Rhodopseudomonas palustris CGA009)
MTALNALNLLRPGSVDEAIAALLAHPGGWLLGGGTDLLVNMRRGVTQPETLIDTTGIAEI
KQLVADGSGLTIGAGVTLASLAADGLVAARYPALSEAARAVAGPGHRKLGTVGGNLCLDT
RCIYYNQSEWWRRANSYCLKNRGEICHVAPKGNRCHAAFSGDLAPALLVLGAEVEIAGPD
GRRRIPLGELYVEDGRAHLALRPGEVVVTVRLPADPLASRYVKVRQRGAIDYPLAGVAVA
LARSGSRLAQLRIALTGTNSRPFLLAETAAFAQRSLDDALLREIDRLVQKQVQPMRTTLM
PANYRRVVAAALASRITAELFASLAPA