Protein Info for TX73_003470 in Rhodopseudomonas palustris CGA009

Annotation: 4-hydroxybenzoyl-CoA reductase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03193: 4-hydroxybenzoyl-CoA reductase, gamma subunit
  • amino acids 12 to 159 (148 residues), 299.1 bits, E=2.5e-94
• PF00111: Fer2
  • amino acids 16 to 65 (50 residues), 34.2 bits, E=2e-12
• PF01799: Fer2_2
  • amino acids 83 to 156 (74 residues), 112.1 bits, E=1.1e-36

Best Hits

Swiss-Prot: 62% identical to HCRC_THAAR: 4-hydroxybenzoyl-CoA reductase subunit gamma (hcrC) from Thauera aromatica

KEGG orthology group: K04107, 4-hydroxybenzoyl-CoA reductase subunit gamma [EC: 1.3.7.9] (inferred from 100% identity to rpa:RPA0670)

MetaCyc: 100% identical to 4-hydroxybenzoyl-CoA reductase HbaB subunit (Rhodopseudomonas palustris CGA009)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-coumarate degradation (anaerobic) (5/6 steps found)
• phenol degradation II (anaerobic) (2/4 steps found)
• 4-ethylphenol degradation (anaerobic) (3/6 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (8/27 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.7.9

Use Curated BLAST to search for 1.1.7.1 or 1.3.7.9

Protein Sequence (163 amino acids)

>TX73_003470 4-hydroxybenzoyl-CoA reductase subunit gamma (Rhodopseudomonas palustris CGA009)
MDETMLRRRKRLLGLNVNGRWREDAVTDDMLLVDYLRDIAGLTGVKTGCDGGECGACTVL
IDGEAAPSCLVLAVRCEGRYIETVEGLAANGRLHRLQQTFHERLGAQCGFCTPGMIMAAE
GLLRRNPSPTDEEIRTALSGNLCRCTGYAKIVESVQAAAEIAP