Protein Info for TX73_003385 in Rhodopseudomonas palustris CGA009

Annotation: 2-ketocyclohexanecarboxyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03210: 2-ketocyclohexanecarboxyl-CoA hydrolase
  • amino acids 3 to 258 (256 residues), 550 bits, E=3.1e-170
• PF00378: ECH_1
  • amino acids 9 to 256 (248 residues), 226.6 bits, E=3.3e-71
• PF16113: ECH_2
  • amino acids 15 to 249 (235 residues), 81.4 bits, E=9e-27

Best Hits

Swiss-Prot: 48% identical to MENB_ECOLI: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Escherichia coli (strain K12)

KEGG orthology group: K07536, 2-ketocyclohexanecarboxyl-CoA hydrolase [EC: 3.1.2.-] (inferred from 99% identity to rpt:Rpal_0720)

MetaCyc: 100% identical to BadI (Rhodopseudomonas palustris)
3.7.1.-

Predicted SEED Role

"2-ketocyclohexanecarboxyl-CoA hydrolase (EC 4.1.3.36)" (EC 4.1.3.36)

MetaCyc Pathways

• benzoyl-CoA degradation III (anaerobic) (7/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
• superpathway of menaquinol-10 biosynthesis (5/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of menaquinol-9 biosynthesis (5/10 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (4/9 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 4.1.3.36

Protein Sequence (260 amino acids)

>TX73_003385 2-ketocyclohexanecarboxyl-CoA hydrolase (Rhodopseudomonas palustris CGA009)
MQFEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDR
AFCTGGDQSTHDGNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDL
TICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANL
CVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYYDTDES
REGVKALQEKRKPEFRKYIK