Protein Info for TX73_003375 in Rhodopseudomonas palustris CGA009

Annotation: cyclohexanecarboxylate-CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 91 to 114 (24 residues), see Phobius details amino acids 252 to 263 (12 residues), see Phobius details TIGR03208: cyclohexanecarboxylate-CoA ligase" amino acids 3 to 540 (538 residues), 1099.2 bits, see alignment E=0 PF00501: AMP-binding" amino acids 33 to 407 (375 residues), 297.9 bits, see alignment E=1e-92 PF13193: AMP-binding_C" amino acids 456 to 532 (77 residues), 50.3 bits, see alignment E=3.9e-17

Best Hits

KEGG orthology group: K04116, cyclohexanecarboxylate-CoA ligase [EC: 6.2.1.-] (inferred from 100% identity to rpa:RPA0651)

MetaCyc: 100% identical to AliA (Rhodopseudomonas palustris)
6.2.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>TX73_003375 cyclohexanecarboxylate-CoA ligase (Rhodopseudomonas palustris CGA009)
MEFDAVLLPPRRAASIAAGLWHDRTINDDLDACVAHCPDKVALTAVRLDGGAVRRFSYRE
LATLADRVAVGLNRLGVGRGDVVAMQLPNWWQFTVLYLACSRIGAVLNPLMPIFRERELS
FMLKHGDAKVLVVPKSFRGFDHEAMARSLQPDLPALRTIVVVDGGGADDFDTLLTTPEWE
KQPDAAAILQGSRPSPDDITQLIYTSGTTGEPKGVMHSANTLMANIVPYAQRLALRESDV
ILMASPMAHQTGFMYGLMMPIMLRASAVLQDIWEPTKAAELIRTERVTFTMASTPFLTDL
TRVVKESGEPVPSLKTFLCAGAPIPGPLVEQAQAGLGAKIVSAWGMTENGAVTLIKLDDD
DKLASTTDGCPLPGVEVKVIDGDGKTLPPNQIGRLVVRSCSNFGGYLKRPHWNGTDADGW
FDTGDLAYMTADGYIRISGRSKDVIIRGGENIPVVEVEALLYKHPAVAQVAIVAYPDERL
GERACAVVVPKTGASIDFAAMVEFLKAQKLALQYIPERLVVRDAMPATPSGKIQKFRLRE
MLQHNDL