Protein Info for TX73_003205 in Rhodopseudomonas palustris CGA009

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 332 to 358 (27 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF13000: Acatn" amino acids 10 to 100 (91 residues), 43.9 bits, see alignment E=1.3e-15 PF07690: MFS_1" amino acids 13 to 381 (369 residues), 74.6 bits, see alignment E=7.4e-25

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 100% identity to rpt:Rpal_0623)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>TX73_003205 MFS transporter (Rhodopseudomonas palustris CGA009)
MAVYLQPRVLVVLFLGFSSGLPLALSGSTLLVWMRESGVDLGTIGLFALVGTPYTLKFIW
APLVDALHVPLFTRAFGRRRGWLVFVQLLLIAAVLLLALTDPAKSPLYVAIGALLVATAS
ATQDIVVDAFRVESLPEEEQAAGMASYVAAYRIGMLISTAGVLFLVSAYEGTGLTRTTAW
MWGYVTMAAMVLIGTVTALLATEPEQSRRAEAATSGESALKRVIHAALGAFTEFLTRKDA
LTALAFVVLFKFTDAFSGTMTAPFVIDLGYSRNDYAAIVKGVGLAATLIGGFAGGYLARR
YSLVASLWIGAVLQAVSNLAFAWLSTVGVNQWALALAISVENFTGAIGTVIFVAYLSALC
QNPLHTATQYALLTALAAVGRTYLSASAGYVAQATGWPAFFTISVAVAAPSLVLLAWLQR
RGHFAALGPVKV