Protein Info for TX73_002965 in Rhodopseudomonas palustris CGA009

Annotation: ActS/PrrB/RegB family redox-sensitive histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details PF00512: HisKA" amino acids 213 to 272 (60 residues), 34.3 bits, see alignment E=2e-12 PF02518: HATPase_c" amino acids 322 to 426 (105 residues), 57.3 bits, see alignment E=2e-19

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to rpa:RPA0572)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>TX73_002965 ActS/PrrB/RegB family redox-sensitive histidine kinase (Rhodopseudomonas palustris CGA009)
MSDDLISADFRHPRRHVRLDTILRLRWLAALGQLSAIFVVSEGLEFDFAVMPCIVIIAVS
GLVNLALQIAFNPMQRMEPIYAALLLALNISELAGLLYFTGGLQNPFAFLFLGPVLISAT
ALPTRMTISLGIFAAGCAAFLGYSHLPLPWAGEEPVALPRIYLVGVWLSILLAIGVTSLY
TFQVTEEARKLADALSAAELVLEREQHLTQLDGLAAAAAHELGTPLSTIFLISRELEKTA
PPEMASDLRTLREQAQRCREILGKIAQLSSAGAPFDRMPLSTLIEEAVAPHRDFGIAIKI
RLAQHGEPEPVVMRNPAILYGIGNILENAVDFARTAVEVNAWWNAETVQIVVSDDGPGIK
PDVLRRIGEPYLSRRRSADDPNRERSGLGLGVFIARTLLERTGAKVEFRNKTFPDHGAIV
QLSWPRNRFETIEKTEETMA