Protein Info for TX73_002915 in Rhodopseudomonas palustris CGA009

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details PF04632: FUSC" amino acids 18 to 300 (283 residues), 68.9 bits, see alignment E=7.6e-23 PF06081: ArAE_1" amino acids 24 to 160 (137 residues), 29.2 bits, see alignment E=1.8e-10 PF13515: FUSC_2" amino acids 31 to 158 (128 residues), 57.2 bits, see alignment E=4e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_0565)

Predicted SEED Role

"FIG01006137: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>TX73_002915 FUSC family protein (Rhodopseudomonas palustris CGA009)
MTSSRTRLLSQWKPRRPQWGLALRITLAALLALGFAQSLHLHLPLWAVLTAIIVTQTSVG
RSLKTAGDYLIGTIGGAIYGGAITIFVPHHSELGLLGALALAVAPLALLAAIKPNLNVAT
VTAIIVLLVPTITKVEPLASAIDRVLEVGVGAIVGLAVSFVVLPSRAQGQALAAAARSLE
LMADALGALLAGLTKGLDNDALHRLQDGIGASLVTLAEIGAEAQRERNAGLSRGPDVAPL
VRTLLRLRHDLVIVGRAVTAPLPPSLQDRLGGAVDNLRLAATSHLSACAKALRERRAPPP
LGPMEQALAAYVTEVAAVRRDGLIRALPGDQAERFFALGFAMEQLHQNFRDLEMRVTEWA
LPGKPTARVV