Protein Info for TX73_002840 in Rhodopseudomonas palustris CGA009

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 264 to 266 (3 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details amino acids 308 to 336 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 9 to 341 (333 residues), 172.6 bits, see alignment E=6.4e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0548)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>TX73_002840 AI-2E family transporter (Rhodopseudomonas palustris CGA009)
MPASENKFFILLLVVATGLFGWILWPLYSAVLWGMVIAILFAPLNRGLNRAFGFRRNLAA
LMSVTIIVLMVLLPMSLLGAALAREAAGMYTKIESGNLDLLKTMRELLAARPDWLGDLLS
RFGVGNLADIQQRLSAALLRGSQYLAGQALDIGQSTFDFTVNLFVMVYLLFFLLRDGDLL
AARIRRATPLGVDHQTRLLDKFTVVIRATVKGNMLIALIQGALGGLAFYVLGISGALMWA
VVMAFLSLLPAVGAGIVWLPMALYLIASGSVWHGVGLIVWGMLVIGMVDNFLRPILVGKD
TRMPDYVVLISTLGGLEVFGLNGFVIGPVIAAMFIATWDIYSIAREDAGDTPRIGTGAGT
GLAAVAPSEPAGPVPVRSDSGTTPVA