Protein Info for TX73_002655 in Rhodopseudomonas palustris CGA009

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 907 TIGR01070: DNA mismatch repair protein MutS" amino acids 24 to 900 (877 residues), 851.7 bits, see alignment E=3.5e-260 PF01624: MutS_I" amino acids 25 to 138 (114 residues), 143 bits, see alignment E=1.1e-45 PF05188: MutS_II" amino acids 147 to 274 (128 residues), 82.2 bits, see alignment E=1.1e-26 PF05192: MutS_III" amino acids 295 to 593 (299 residues), 154 bits, see alignment E=1.6e-48 PF05190: MutS_IV" amino acids 457 to 551 (95 residues), 72 bits, see alignment E=1e-23 PF00488: MutS_V" amino acids 652 to 839 (188 residues), 280.6 bits, see alignment E=1.8e-87

Best Hits

Swiss-Prot: 100% identical to MUTS_RHOPA: DNA mismatch repair protein MutS (mutS) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to rpa:RPA0512)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (907 amino acids)

>TX73_002655 DNA mismatch repair protein MutS (Rhodopseudomonas palustris CGA009)
MTIRPDIALPPDAAPPPEAPAKMSPMMEQYHEIKAANPGLLLFYRMGDFYELFFEDAEIA
SRALGITLTKRGKHLGADIPMCGVPVERSDDYLHRLIALGHRVAVCEQTEDPAAARARKS
VVRRDVVRLITPGTLTEDTLLDARANNYLLAIARARGSAGADRIGLAWIDISTGEFCVTE
CSTAELAATLARINPNEAIVPDALYSDTELAPTLRELAAVTPLTRDVFDSATAERRLCDY
FAVATMDGLAALSRLEATAAAACVTYVDRTQLGKRPPLSPPAREATGSTMAIDPATRANL
ELTRTLAGERRGSLLDAIDCTVTAAGSRLLAQRLAAPLTDAATIARRLDAVEAFAVDSGL
REQIRSSLRAAPDMARALARLSLGRGGPRDLANLRDGIRAADEVLVQLAQLASPPQEIAS
AMAALQRPSRELCAELGRALADDLPLLKRDGGFVREGYEPALDETRKLRDASRLVVASMQ
ARYADDTGIKALKIRHNNVLGYFVEVSAQHGEKLMAPPLNATFIHRQTLAGQVRFTTAEL
GEIEAKIANAGDRALGLELEIFDRLAGSIDAAGDDLRAAAHAFALLDVATALAKLASDDN
YVRPEVDESLAFAIEGGRHPVVEQALKRAGEPFIANACDLSPGPAQKNGQIWLLTGPNMA
GKSTFLRQNALIALLAQVGSFVPAIRARIGIVDRLFSRVGAADDLARGRSTFMVEMVETA
AILNQASERALVILDEIGRGTATFDGLSIAWAAIEHLHEQNRCRSLFATHYHELTALSAK
LPRLFNATVRVKEWRGEVVFLHEVLPGSADRSYGIQVAKLAGLPPSVVSRAKAVLAKLEA
NDRGQPKTLIDDLPLFAITARAPAEAAPPSEAEQLIDAVKALHPDEMTPREALDALYALK
AKLPKAD