Protein Info for TX73_002325 in Rhodopseudomonas palustris CGA009

Annotation: tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00919: UPF0004" amino acids 6 to 109 (104 residues), 98.2 bits, see alignment E=3.7e-32 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 6 to 447 (442 residues), 450.6 bits, see alignment E=6.5e-139 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 6 to 445 (440 residues), 466.2 bits, see alignment E=9.9e-144 PF04055: Radical_SAM" amino acids 161 to 333 (173 residues), 92 bits, see alignment E=7.3e-30 PF01938: TRAM" amino acids 390 to 447 (58 residues), 29.8 bits, see alignment 6.7e-11

Best Hits

Swiss-Prot: 100% identical to MIAB_RHOPA: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 100% identity to rpa:RPA0448)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>TX73_002325 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB (Rhodopseudomonas palustris CGA009)
MSPPRKLHIKSYGCQMNVYDAQRMVDALAPEGFVETANVDDADLVILNTCHIREKASEKV
YSELGRLRVARDEAANHGRRMQIAVAGCVAQAEGAEIIRRAPVVDVVVGPQSYHNLPQLL
AKAEQHGRALETEFPIEDKFGVLPQPAPDAIRARGISAFVTVQEGCDKFCTFCVVPYTRG
AEMSRPVAAIVEDVKRLAENGVREVTLIGQNVNAYHGDGPDRLAWSLGRLVRRLAEIPGI
VRLRYSTSHPNDVNDDLLAAHRDLPALMPFVHLPVQSGSDRILAAMNRKHTADDYRRVID
RFRLASEAIAFSSDFIVGFPGETERDFSATLALVAQIGYAGAYSFKYSPRPGTPAADMAE
MVPAAVMDERLEQLQQLIDQQQSAFNKAAIGRTVEVLFERAGRKPGQIVGRTAYLQPAHV
MAPDSIIGKVLPVRVDSLERYSLLGELASATSRPADAMAATGA