Protein Info for TX73_002310 in Rhodopseudomonas palustris CGA009

Annotation: hemolysin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00571: CBS" amino acids 94 to 149 (56 residues), 26.3 bits, see alignment 7.7e-10 amino acids 190 to 239 (50 residues), 27.1 bits, see alignment 4.2e-10 PF03471: CorC_HlyC" amino acids 256 to 336 (81 residues), 61.5 bits, see alignment E=6.1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_0449)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>TX73_002310 hemolysin family protein (Rhodopseudomonas palustris CGA009)
MPDGDRAENGSQASLQDSTRGQLPAVVHQGEVLHPHGGSWLIRAIRSLFGWKPGSVRDDL
QVVLDTSPPDDTGFSTLERTMLRNILGLHDRRIADVMVHRADIVAIKQDIQLGELLSLFQ
DAAHSRLVVYNETLDDPVGIVHIRDLVAFMTAKAKVPPATVAKRKKALPAGLDLRAIDLK
MPLTETGIIRKLLYVPPSMRAIDLLAQMQAARIHLALVVDEYGGTDGLVSIEDIVEQIVG
EIDDEHDSTEPPSIVRQADGSFIADARASLEDVRAMIGDQFVTGEAGEDVETLGGYLVNH
VGRLPVRGEVIAGPGTFEFEVLDADPRRVKRLRIGPRKERPAPRTRDSRRRETATDSTAP
QTTDSGGSTSSPPAGDGTGSP