Protein Info for TX73_002235 in Rhodopseudomonas palustris CGA009

Annotation: LysR substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 4 to 63 (60 residues), 68.2 bits, E=4.8e-23
• PF03466: LysR_substrate
  • amino acids 89 to 299 (211 residues), 153 bits, E=7.6e-49

Best Hits

Swiss-Prot: 41% identical to OXYR_ECOLI: Hydrogen peroxide-inducible genes activator (oxyR) from Escherichia coli (strain K12)

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 100% identity to rpt:Rpal_0434)

MetaCyc: 41% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Protein Sequence (312 amino acids)

>TX73_002235 LysR substrate-binding domain-containing protein (Rhodopseudomonas palustris CGA009)
MISLRQLRYLSALARHGHFGRAADACSVTQPALSMQIAELERTLGIKVVERRPGEVFLTD
IGREIARRAEEVLAATRDLVDFARHRAKPLTGRLSLGVIPSLAPYLLPKVLPLLLQHFPE
LRLELRESQTRPLVADVVSGVLDAALLALPVGHSDLDAIPLFDDPFLLAVPADDPRAETT
PIGVEEIDQSRLILLEDGHCLRDQALAFCATARNRGIQMGSAGTASFGASSLTTVIQMVA
GGYGITLIPQIAAEVERRDSRVKFLRLRRPQPGRSVGLVFRKTSPRRGDFEAFGEVVKQG
IGGAAPIESAVA