Protein Info for TX73_002180 in Rhodopseudomonas palustris CGA009

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 133 to 154 (22 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details PF00106: adh_short" amino acids 5 to 192 (188 residues), 143.5 bits, see alignment E=8.6e-46 PF08659: KR" amino acids 6 to 169 (164 residues), 36.2 bits, see alignment E=8.8e-13 PF13561: adh_short_C2" amino acids 10 to 202 (193 residues), 105.1 bits, see alignment E=6.7e-34

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 100% identity to rpa:RPA0419)

Predicted SEED Role

"Short-chain dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>TX73_002180 SDR family oxidoreductase (Rhodopseudomonas palustris CGA009)
MTERVTLITGASAGIGVELARIFADNAHRVALVARRGDRLESLAAEIRAKGGPEPIVIAC
DLGKPDAAEQIIAALAAAGVEVEYLVNNAGYGLFGRAMELDRESQLGIIDVNNRALTDLT
LRFADSIARLRGGILNVASIAGFLPGPGMAVYYASKAYVLSFSEAMHQELGPKGVRVTAL
CPGPVQTEFQNRAGFEPGFDSAVLNVTPAEVARQAYQGLMNNKRIVLPGLGVKIVPFLLR
FFPRGFIAAAVSGFQLRRR