Protein Info for TX73_002105 in Rhodopseudomonas palustris CGA009

Annotation: TAXI family TRAP transporter solute-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 343 to 364 (22 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 14 to 328 (315 residues), 93.1 bits, see alignment E=7.6e-31 PF16868: NMT1_3" amino acids 43 to 328 (286 residues), 69.1 bits, see alignment E=7.4e-23 PF13379: NMT1_2" amino acids 79 to 221 (143 residues), 28 bits, see alignment E=2.8e-10 PF09084: NMT1" amino acids 136 to 201 (66 residues), 42 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0405)

Predicted SEED Role

"FIG01006675: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>TX73_002105 TAXI family TRAP transporter solute-binding subunit (Rhodopseudomonas palustris CGA009)
MLQPSLRSPWRRMLLIILATTLSLIGIASAGYYFAMRPVTLKIAVGPQAGDDYKLIQALT
QVFARERNTVRLRPVVTDGPAASALALKSGAVDLAVIRGDLPVPKQAQSVAVLHKNVAVL
WAPASQQPKGKRKGSKTAGIAGITDLTGKRVGVVGRTEANAGLLTVILQQYGVDPSKVQT
LSVPVAEVADAVRTGKVDALLAAGPLNSKIIGDAVAATAHTGREPVFLSIESSEALAANH
PSYEAASIPAGAFGGAPARPDNEVKTVSFSHYIVAREGASDTTIATFTEQLFTARQIVIG
EVPLAAKIETPDTDKDAVIPVQPGAAAYVDGEEKSFLDRYSDLIWFSLMGLSLMGSAGAW
FASFLRKDERTSTASQRERLLDMLATARRCSSAEDLDTMQTEADAILRDTLTAYENGAID
SAALTAFSIALEQFHNAVTDRKLLLADVSPLPPLRGVRPQAV