Protein Info for TX73_002100 in Rhodopseudomonas palustris CGA009

Annotation: 4a-hydroxytetrahydrobiopterin dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 3 to 93 (91 residues), 117.1 bits, E=1.6e-38

Best Hits

Swiss-Prot: 100% identical to PHS_RHOPA: Putative pterin-4-alpha-carbinolamine dehydratase (RPA0404) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 99% identity to rpt:Rpal_0408)

MetaCyc: 56% identical to Pterin-4-alpha-carbinolamine dehydratase (Homo sapiens)
4a-hydroxytetrahydrobiopterin dehydratase. [EC: 4.2.1.96]

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• tetrahydropteridine recycling (1/2 steps found)
• L-phenylalanine degradation V (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Protein Sequence (100 amino acids)

>TX73_002100 4a-hydroxytetrahydrobiopterin dehydratase (Rhodopseudomonas palustris CGA009)
MNRLSASERQAALRELPGWLELEEREAIGRSYQFKDFSEAFGFMTRVALAAEKADHHPEW
RNVYRTVDVVLTTHDAGGVTERDVKLAKAMDAIAERCGAR