Protein Info for TX73_002000 in Rhodopseudomonas palustris CGA009

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF20582: UPF0758_N" amino acids 24 to 93 (70 residues), 35.9 bits, see alignment E=6.3e-13 TIGR00608: DNA repair protein RadC" amino acids 26 to 234 (209 residues), 229.9 bits, see alignment E=1.5e-72 PF04002: RadC" amino acids 119 to 235 (117 residues), 148.2 bits, see alignment E=1.1e-47

Best Hits

Swiss-Prot: 90% identical to Y700_RHOP2: UPF0758 protein RPB_0700 (RPB_0700) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to rpt:Rpal_0389)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>TX73_002000 DNA repair protein RadC (Rhodopseudomonas palustris CGA009)
MPTDNAERLQQPGFAEAPHYHGHRERLRERFREAGSDALSDYELLELVLFRALPRRDVKP
IAKELIARFGSFAEAVHAPAERLREVSGVGDAAIIEIGLIAAAAARVTKGQVKQRTVLSS
WSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVGTVDHTPVYPREIVKRGLELS
ATAVIMVHNHPSGDPTPSQADIQMTKSIVAIAEPLGIAVHDHIIVGKNGHASLKGLRLI