Protein Info for TX73_001970 in Rhodopseudomonas palustris CGA009

Annotation: 1-phosphofructokinase family hexose kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 4 to 310 (307 residues), 329 bits, E=1.1e-102
• PF00294: PfkB
  • amino acids 13 to 297 (285 residues), 181.6 bits, E=2.3e-57
• PF08543: Phos_pyr_kin
  • amino acids 161 to 278 (118 residues), 33.7 bits, E=2.6e-12

Best Hits

Swiss-Prot: 36% identical to K1PF_XANCP: 1-phosphofructokinase (fruK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 99% identity to rpt:Rpal_0383)

Predicted SEED Role

"Tagatose-6-phosphate kinase (EC 2.7.1.144) / 1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization or D-Tagatose and Galactitol Utilization or Lactose and Galactose Uptake and Utilization (EC 2.7.1.144, EC 2.7.1.56)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• homolactic fermentation (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• fructose degradation (1/1 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• galactitol degradation (2/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• lactose degradation I (1/5 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.11 or 2.7.1.144 or 2.7.1.56

Protein Sequence (312 amino acids)

>TX73_001970 1-phosphofructokinase family hexose kinase (Rhodopseudomonas palustris CGA009)
MVDIVTLTPNPAIDLSTSVERLVPSRKLRCAAQKRDPGGGGINVARVVQRLGGNVEAIFP
AGGFTGKLLKLLLDEENVPNRIVEAVAETREDFSVSENATGEQFRFVLPGLPLAEHEWRG
MLETLAATSPAPKIVIGSGSLPPGVPVDFYAQAAAVAKQLGAKFFLDTSGKPLTAALAQG
VTLIKPNLREMQELAGRPLGCEKEWVDAARAHITAGQVEIVALSLGHLGALLVTKDEALR
SPALPVTPVSTVGAGDSFLAAIAHRLAQGGSVADAFRLGLAAGSATLTVHGTQLCGPAEV
ERLYGQVIIEPI