Protein Info for TX73_001930 in Rhodopseudomonas palustris CGA009

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to MEGL_PSEPU: L-methionine gamma-lyase (mdeA) from Pseudomonas putida

KEGG orthology group: K01758, cystathionine gamma-lyase [EC: 4.4.1.1] (inferred from 100% identity to rpa:RPA0371)

MetaCyc: 56% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
L-cysteine degradation II (3/3 steps found)
L-methionine degradation II (3/3 steps found)
L-tryptophan degradation II (via pyruvate) (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
L-threonine degradation I (5/6 steps found)
superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
dimethyl sulfide biosynthesis from methionine (2/2 steps found)
superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
homocysteine and cysteine interconversion (3/4 steps found)
D-serine degradation (2/3 steps found)
L-serine degradation (2/3 steps found)
seleno-amino acid detoxification and volatilization III (2/3 steps found)
hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
seleno-amino acid detoxification and volatilization I (1/2 steps found)
superpathway of L-threonine metabolism (12/18 steps found)
superpathway of L-methionine salvage and degradation (10/16 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
glycine betaine degradation III (3/7 steps found)
purine nucleobases degradation II (anaerobic) (15/24 steps found)
glutathione-mediated detoxification I (3/8 steps found)
glycine betaine degradation I (3/8 steps found)
superpathway of seleno-compound metabolism (8/19 steps found)
hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.1

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>TX73_001930 methionine gamma-lyase (Rhodopseudomonas palustris CGA009)
MTESSHSPGFATTAIHHGYDPLAHHGALNPPLFLTSTYAFASAAEGAARFAGEAEGFVYS
RVGNPTVAVLESRLAALEGGEAALATASGVGALTALIWTLLKTGDGIIADQMLYGCTFGL
FEHHLPRFDIEVVFADLTDPANLQAALRPNTRLVFTETPTNPNMRLVDIAACAEICRRAD
ARLVVDNTYCTPYLQRPLDLGADLVTHSATKYLGGHGDLLAGAVVGPKEIIDQVRFVGVK
ELNGACISAFDAFLILRGLKTLNLRMDRHSATAVKLAHDLEAHPAVAAVYYPGLDSHKQR
NLAQRQMRQPGGMIALELRGGLAAGRSFMDKVKLATRAVSLGDAETLIQHPASMTHATYD
PAERARHGFTDGLIRISVGLEDYEDLKQDLLGAL