Protein Info for TX73_001885 in Rhodopseudomonas palustris CGA009

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 147 to 176 (30 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details PF01925: TauE" amino acids 13 to 256 (244 residues), 167.8 bits, see alignment E=1.6e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to rpa:RPA0364)

Predicted SEED Role

"Possible permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>TX73_001885 sulfite exporter TauE/SafE family protein (Rhodopseudomonas palustris CGA009)
MLPNIPFTDLVTVASGALVGFILALIGGGGSVLAVPLLVYVVGVRSPHMAIGTSSIAVAI
SALANMLSHWAAGNVRWACAVVFSAAGIGGAFAGATIAKQVDGQKLLILFGLLMIVIGAL
MLRKNRGGGDPAVRLTRDTARAMLPRLIGTGFGVGLLAGFFGIGGGFLIVPGLILATGMP
LTSAIGTSLVAVVAFGASTATSYALSGLIDWRLAGTFIGGGLIGGLIGIGTGKLIGGHDK
VLRSVFSAVVIAVGLYVCYRGAMYFLT