Protein Info for TX73_001750 in Rhodopseudomonas palustris CGA009
Annotation: orotidine-5'-phosphate decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PYRF_RHOPA: Orotidine 5'-phosphate decarboxylase (pyrF) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to rpt:Rpal_0340)MetaCyc: 41% identical to orotidine-5'-phosphate decarboxylase (Escherichia coli K-12 substr. MG1655)
Orotidine-5'-phosphate decarboxylase. [EC: 4.1.1.23]
Predicted SEED Role
"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
- UMP biosynthesis II (6/6 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
- UMP biosynthesis I (5/6 steps found)
- UMP biosynthesis III (5/6 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.23
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (237 amino acids)
>TX73_001750 orotidine-5'-phosphate decarboxylase (Rhodopseudomonas palustris CGA009) MAPVDIPDRDRLIVALDLPDLRVAEAMVDRLGDSVGFYKIGYQLAYAGGLPLARALVGAG KKVFVDLKLHDIGNTVARGVESLSHLGASFLTVHAYPQTMKAAVEARGSSKVKILAVTVL TSYDDRDLADAGYRFGVRDLVEARARQAQAIGVDGLVCSPEEAAHLRSIVGPEMDLVTPG IRPAGAAAGDQKRIMTPAKAIAAGASYLVVGRPVLDAPDPKAAADAIVAEIAAARGS