Protein Info for TX73_001665 in Rhodopseudomonas palustris CGA009

Annotation: HTH-type quorum sensing-dependent transcriptional regulator RpaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF03472: Autoind_bind" amino acids 27 to 167 (141 residues), 122.2 bits, see alignment E=1.4e-39 PF00196: GerE" amino acids 181 to 235 (55 residues), 67.4 bits, see alignment E=6.4e-23

Best Hits

Swiss-Prot: 100% identical to RPAR_RHOPA: HTH-type quorum sensing-dependent transcriptional regulator RpaR (rpaR) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 100% identity to rpt:Rpal_0323)

Predicted SEED Role

"transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>TX73_001665 HTH-type quorum sensing-dependent transcriptional regulator RpaR (Rhodopseudomonas palustris CGA009)
MIVGEDQLWGRRALEFVDSVERLEAPALISRFESLIASCGFTAYIMAGLPSRNAGLPELT
LANGWPRDWFDLYVSENFSAVDPVPRHGATTVHPFVWSDAPYDRDRDPAAHRVMTRAAEF
GLVEGYCIPLHYDDGSAAISMAGKDPDLSPAARGAMQLVSIYAHSRLRALSRPKPIRRNR
LTPRECEILQWAAQGKTAWEISVILCITERTVKFHLIEAARKLDAANRTAAVAKALTLGL
IRL