Protein Info for TX73_001635 in Rhodopseudomonas palustris CGA009

Annotation: type I pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00554: pantothenate kinase
  • amino acids 12 to 317 (306 residues), 424.2 bits, E=1.6e-131
• PF00485: PRK
  • amino acids 91 to 244 (154 residues), 47.7 bits, E=8.7e-17

Best Hits

Swiss-Prot: 100% identical to COAA_RHOPA: Pantothenate kinase (coaA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00867, type I pantothenate kinase [EC: 2.7.1.33] (inferred from 100% identity to rpa:RPA0315)

Predicted SEED Role

"Pantothenate kinase (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• phosphopantothenate biosynthesis II (1/3 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Protein Sequence (318 amino acids)

>TX73_001635 type I pantothenate kinase (Rhodopseudomonas palustris CGA009)
MDARSDLHHYNPYRVFSRAEWASMREDTPMTLDAAEVAALRSMHDRLDLSEVEEIYLPMS
RLLSIHVAAMQQLYYAQRRFLGVVERKMPFIIGVAGSVAVGKSTTARVLQALLARWSPRP
TVDLVTTDGFLHPNAVLERAGLMQKKGFPESYDLPALLGFLSDIKSGRRKVKAPIYSHLT
YDIVPNKFTVIDRPDILIVEGVNVLQTGRLPRDGKAVPVVSDFFDFSVYLDADEPVLRDW
YVRRFLALRDTAFHDPRSYFHRYAVLSDEEATATAIAIWERTNLANLEDNILPTRPRATL
ILKKGADHVVDSVALRRL