Protein Info for TX73_001580 in Rhodopseudomonas palustris CGA009

Annotation: murein transglycosylase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03562: MltA
  • amino acids 158 to 323 (166 residues), 195.2 bits, E=7.9e-62
• PF06725: 3D
  • amino acids 345 to 422 (78 residues), 75.5 bits, E=3.2e-25

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 100% identity to rpa:RPA0304)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (497 amino acids)

>TX73_001580 murein transglycosylase A (Rhodopseudomonas palustris CGA009)
MGPAAAPDVRGARRAALAGCVLAAALLSALGEADARSRHHHSGARSVSKFAEHHAKYLHP
LWPLEIPGGQYLPVAWSEIPGWDSDDQLAALKTFRVSCRPILAAGRAPSTDKPLGGSLWE
PCHAARSAHLTTAAEARAFFEQHFVPLQISRLGEPLGFVTGYYEPVIEGSPVKTDDYVVP
VYRRPSNLFVRGYKQEAALPNGGPVFRKIGRRKLVPYYDRGEIEDGAIDGRGLEICWLKS
QTDLLFAQIQGSARIKLPDGRVIRINYDAHNGFPYTPVGRILIERGIIPREEMSMHRIRD
WMDANPDGAKELRRANRSYVFFRKVELKDDDEAIGAQGVPLTPGRSIAVDKGLHVYGTPF
FITGELPIESPAAKTPFRRLMIGQDTGSAIVGPARADLYFGAGAEAGAVAGRIRHPIAFA
MLVPKGLDPVARARSLPVPEPRLPAKTNNPAATPSKSGGRDGATTVPTPDSRPATAPSRP
TGHRHRSHHSRHHRHLR