Protein Info for TX73_001535 in Rhodopseudomonas palustris CGA009

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF10396: TrmE_N" amino acids 7 to 121 (115 residues), 115.5 bits, see alignment E=3.4e-37 TIGR00450: tRNA modification GTPase TrmE" amino acids 12 to 441 (430 residues), 271.4 bits, see alignment E=1.6e-84 PF12631: MnmE_helical" amino acids 124 to 438 (315 residues), 164.4 bits, see alignment E=8.5e-52 TIGR00231: small GTP-binding protein domain" amino acids 219 to 315 (97 residues), 64.4 bits, see alignment E=1.1e-21 PF02421: FeoB_N" amino acids 220 to 302 (83 residues), 31 bits, see alignment E=3.4e-11 PF01926: MMR_HSR1" amino acids 221 to 307 (87 residues), 78.2 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 100% identical to MNME_RHOPA: tRNA modification GTPase MnmE (mnmE) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 100% identity to rpa:RPA0295)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>TX73_001535 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Rhodopseudomonas palustris CGA009)
MHPSDQTIFALATGPLPSAIAIVRVSGSRAGEVLTALTGSLPPPRRAVRCDLRSRDGDLI
DDGVALWFPTPASATGEDVAELHIHGSRAVAAALIKTLSAFEGVRPAEPGEFTRRGFENG
KLDLTEAEGLDDLIHADTDAQRRQALRQLGGVLGDRARRWRDQIIEALALVEAGIDFSDE
GDVADELMGPARAKIAELSAEIAEVLAEQGRGEKLRDGMVVAIAGPPNVGKSTLINRLAR
REVAIVSPHAGTTRDVIEIQLDLDGYPVTVIDTAGLRDSDDPVEQEGVRRARSRAAAADL
VLWLSTATDASDPDVKGPEVWRVRNKIDLATGEVAESGPSQPVFRISAATGEGFADLLRE
LTRFAAQYFGSAEAGLITRDRHRRLLADAAASLTRSLVPGLAEEIVAEELRASAHSLGRL
LGRVDVEDVLGEIFGRFCIGK