Protein Info for TX73_001375 in Rhodopseudomonas palustris CGA009

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 107 to 117 (11 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 331 (324 residues), 108.8 bits, see alignment E=3.1e-35 PF19040: SGNH" amino acids 416 to 639 (224 residues), 129.8 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0264)

Predicted SEED Role

"InterPro IPR002656 COGs COG1835"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (645 amino acids)

>TX73_001375 acyltransferase family protein (Rhodopseudomonas palustris CGA009)
MRPAYRSDIDGLRAIAVLLVVGFHAFPAEVRGGFIGVDVFFVISGFLITSIICQALDRGD
FSFATFYARRINRIFPALLLVLAACAIGGWFLQFPVDYRDAGKAIGFGAAFLANIALLHD
SGYFDTSSELNPLLHLWSLGVEEQFYLLWPPVIILAWRWKNGAVVAAVAILLTSFVTNLL
LTPTHQSAAFYLPVTRFWELMTGCLLAIATATRAAPLAQHAARLRNIGAVAGLALIATGA
TLIDRSRAFPGWWAVLPVLGAALLIASGPGTWVGRRLLGNRAMVYVGLISYPLYLWHWPV
LAAIRIVRLGEEPPPLMKLIAVLVAFGLADFTYRFVEPKIRYRPTRAKTAAAFAGVALVG
LVGAGIYVAGGVPSRFSAGVQIVARDHQAEAMPAYRLKSCFLSSGSTFARECDDAALPGV
PRIALWGDSHAAHLYPGLRAVQESEGGFVLSQYTTAGCPPIFGYVSVQTQGCTAANATAR
ERLKAVKPDTVILVARQWHDYDGADRDPAAIDAMIKATLAELHSIGIRRIVVVGKFPSWR
TPPKRILAQAYRSEAAGLITASEIPTRDGPPKLDRSEAEANERLRAFFTAQGIEFISPTP
VYCNDQGCLLAVPGSGTPVTFDGSHLTIASSQFFVRQIAKELLGR