Protein Info for TX73_001370 in Rhodopseudomonas palustris CGA009

Annotation: secondary thiamine-phosphate synthase enzyme YjbQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 8 to 140 (133 residues), 119.1 bits, see alignment E=5.6e-39 PF01894: UPF0047" amino acids 20 to 137 (118 residues), 132.9 bits, see alignment E=3.1e-43

Best Hits

Swiss-Prot: 43% identical to Y771_METTH: UPF0047 protein MTH_771 (MTH_771) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_0264)

Predicted SEED Role

"Protein of unknown function UPF0047"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>TX73_001370 secondary thiamine-phosphate synthase enzyme YjbQ (Rhodopseudomonas palustris CGA009)
MQIQRHRIELATTAPIQLIDITDQVRRFVTSSGIKEGLVTVSCLHTTARINVNEREEKLE
RDMLTFLKRFVPRDGDYLHNLDPVDGRDNAHSHLIGLFMNSSETIPVAKGTMVLGEWQSV
FFIELDGPRERRGVELQIIG