Protein Info for TX73_001170 in Rhodopseudomonas palustris CGA009

Annotation: YbfB/YjiJ family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF06779: MFS_4" amino acids 26 to 386 (361 residues), 309.9 bits, see alignment E=3e-96 PF07690: MFS_1" amino acids 29 to 333 (305 residues), 64.8 bits, see alignment E=6.8e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0226)

Predicted SEED Role

"FIG01006608: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>TX73_001170 YbfB/YjiJ family MFS transporter (Rhodopseudomonas palustris CGA009)
MTLLDRTEAAPAHPARLILILSLAPTVGLGIGRFAYSLLLPDMRDSLGWSYSAAGFMNTI
NAAGYLVGALVTSRLVARFGMAAIVRVGTLACVASLALCALSGNFAVLSAARLIAGIGAA
LAFVAGGALATTIAQAQPARSAFLLSLFYAGPGIGILSSGLIAPFLLQAAGPGSWWLGWL
VLAALSAAMTLPVLLAPIGGDAGIGGGRAAPFRIAPVVVYLAGYFMFGAGYIAYMTFMIA
YVRDAGGGAAAQSAFWCLIGISAFATPWVWRRVMALHRGGLSTTIILAVNAVGAVLPLFS
LSPVMLATSALVFGVSFFAVVASTTAFVRFNYPQAGWPGAIAAMTIAFGIGQTLGPLVVG
AITDAIGSLSSALAVSAATLALGAALSAFQRPLPK