Protein Info for TX73_001165 in Rhodopseudomonas palustris CGA009

Annotation: superoxide dismutase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00080: Sod_Cu
  • amino acids 38 to 168 (131 residues), 152.3 bits, E=5.2e-49

Best Hits

Swiss-Prot: 61% identical to SODC2_AQUAE: Superoxide dismutase [Cu-Zn] 2 (sodC2) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 99% identity to rpt:Rpal_0224)

MetaCyc: 38% identical to superoxide dismutase (Cu-Zn) (Arabidopsis thaliana col)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (172 amino acids)

>TX73_001165 superoxide dismutase family protein (Rhodopseudomonas palustris CGA009)
MILRALLCTGALLGVTTAAMAADSAKATLKNAEGTEIGTATLTESSKGVTIKLALKGLPP
GEHAFHIHAVGKCEPPFTSAGGHFNPENKKHGKMAEGGAHAGDMPNLDVPASGALSIDVV
NDAVTLAKGKPNSVFKDGGTALVIHAKADDYKSDPAGNAGDRIACGVIEEAK