Protein Info for TX73_001140 in Rhodopseudomonas palustris CGA009

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 29 to 301 (273 residues), 257.4 bits, see alignment E=7.8e-81 PF01545: Cation_efflux" amino acids 33 to 218 (186 residues), 133.1 bits, see alignment E=5.4e-43

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to rpa:RPA0220)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>TX73_001140 cation diffusion facilitator family transporter (Rhodopseudomonas palustris CGA009)
MSHDHHHHHGPGAAHGAGGHSHAPQDFGRAFAIGIALNMVFVVAEAAFGYFSNSMALIAD
AGHNLSDVAGLVVAWIAAGLSKRPPSARYTYGLRGSSILAALFNAVFLLLAVGAIGWEAV
VRLFAPEPVAGITVMVVAGIGIVINAVTAWLFASGRHSDLNIRGAYLHMAADAAVSAAVV
VAGVIILSTGWYWIDPAVSLIVAVVIVWGTWGLLRDSTALSLAAVPRDIDPTAVRAFLSK
LPGVTQVHDLHIWGMSTTEVALTCHLVMPGGSPGDPFLVDLAHELQHDFGIAHTTVQIET
DPNTVCALAPEHVV