Protein Info for TX73_001070 in Rhodopseudomonas palustris CGA009

Annotation: DsbE family thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 18 to 191 (174 residues), 162.2 bits, see alignment E=4.4e-52 PF00578: AhpC-TSA" amino acids 48 to 170 (123 residues), 47.1 bits, see alignment E=4.7e-16 PF08534: Redoxin" amino acids 74 to 185 (112 residues), 53.7 bits, see alignment E=4.2e-18 PF13905: Thioredoxin_8" amino acids 80 to 168 (89 residues), 33.4 bits, see alignment E=9.5e-12

Best Hits

Swiss-Prot: 74% identical to CYCY_BRADU: Thiol:disulfide interchange protein CycY (cycY) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to rpt:Rpal_0204)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>TX73_001070 DsbE family thiol:disulfide interchange protein (Rhodopseudomonas palustris CGA009)
MSDTFDPASPKRRSWLVVLPALLFAGLAVLFWFRLGDSDVSRIPSALIGRPAPQTPLPPL
DGLSRDGSQVAGLDPAMFKGKVSVVNVWASWCVPCHDEAPLLMTLAQDTRIQLVGIDYKD
KPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPETFVIGRDGKIAYKLVGPITPDN
IEKVLKPEISKALAAPQS