Protein Info for TX73_001050 in Rhodopseudomonas palustris CGA009

Annotation: heme ABC exporter ATP-binding protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01189: heme ABC exporter, ATP-binding protein CcmA
  • amino acids 3 to 190 (188 residues), 234.1 bits, E=5.7e-74
• PF00005: ABC_tran
  • amino acids 20 to 155 (136 residues), 100.3 bits, E=1.5e-32

Best Hits

Swiss-Prot: 100% identical to CCMA_RHOPA: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 99% identity to rpt:Rpal_0200)

MetaCyc: 40% identical to cytochrome c maturation protein A (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (2/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Protein Sequence (200 amino acids)

>TX73_001050 heme ABC exporter ATP-binding protein CcmA (Rhodopseudomonas palustris CGA009)
MRLSGRDLRCVRGGREVFAGLAFEASGGEALALVGHNGAGKTSLLRLIAGLLTPEAGTIT
LDGGEPDTPVAEQAHYLGHRDALKPSLSVGENLGFWRDFLGGERTDLSAGIKAVGLGHAA
ELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVKGQELFVGLMQEHLARGGIIV
AATHTPLGIPVREQRIGAAT