Protein Info for TX73_001005 in Rhodopseudomonas palustris CGA009

Annotation: RNA 2',3'-cyclic phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR02258: 2'-5' RNA ligase" amino acids 2 to 176 (175 residues), 137.9 bits, see alignment E=1.7e-44 PF02834: LigT_PEase" amino acids 8 to 83 (76 residues), 58.2 bits, see alignment E=7.9e-20 amino acids 92 to 165 (74 residues), 42.6 bits, see alignment E=5.8e-15 PF13563: 2_5_RNA_ligase2" amino acids 11 to 160 (150 residues), 66.9 bits, see alignment E=2.1e-22

Best Hits

KEGG orthology group: K01975, 2'-5' RNA ligase [EC: 6.5.1.-] (inferred from 99% identity to rpx:Rpdx1_0444)

Predicted SEED Role

"2'-5' RNA ligase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>TX73_001005 RNA 2',3'-cyclic phosphodiesterase (Rhodopseudomonas palustris CGA009)
MPRLFTGLEIPAEISQTLSSLRGGLPGARWVDPDDYHLTLRFIGDIDGVTANEIASTLFR
VNRKPFEVTLQGLSSFGGKKPRAVVASVVPSKPLIELQAELERLMQRVGLDPEGRKFTPH
VTLARLRGDVSSRDVADYLSIRGYFPSKVFKAERFVLYSARASTGGGPYIVEAPYELTA