Protein Info for TX73_000840 in Rhodopseudomonas palustris CGA009

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF00892: EamA" amino acids 19 to 149 (131 residues), 41.6 bits, see alignment E=6.9e-15 amino acids 159 to 283 (125 residues), 38.6 bits, see alignment E=5.9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0161)

Predicted SEED Role

"FIG028883: Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>TX73_000840 DMT family transporter (Rhodopseudomonas palustris CGA009)
MGLFAKITTASDPRTARIAGILLMLLAMLAFSFADAAGKTVVAIYSVGQLLVLRALAGLL
VLSPLIWRQRKAFLQLERPGLQLARTLIAACEVAVFYLATAYLPLADVITFYLASSLFVS
VGAALFLGETIDRPRGIAIVVGFVGVLIALQPSTQTMSWPALIAILASVLFAGLLLLTRF
LRQTPDMVLASQQFAGTLLLGLVLAPSGWITPSATDLVWFAISGAVSAVGLLCVNRSLRL
APASVVVPYQYTMIIFAAAFGWLLFGDVPSRATVAGVAIIIAAGLYLGWRERSTSRPPVG
G