Protein Info for TX73_000660 in Rhodopseudomonas palustris CGA009

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 31 to 58 (28 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 306 (186 residues), 48.8 bits, see alignment E=3.6e-17

Best Hits

Swiss-Prot: 33% identical to YESP_BACSU: Probable ABC transporter permease protein YesP (yesP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to rpa:RPA0128)

Predicted SEED Role

"Multiple sugar ABC transporter, membrane-spanning permease protein MsmF" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>TX73_000660 sugar ABC transporter permease (Rhodopseudomonas palustris CGA009)
MSDAAVSLRDLDALTTARASAKPRRRGRGTVAYGLVAPALTLMLLMLLGPLAGVIALSFT
DYQLGAPSFAWIGLANYQQLFADRVFWISLTNTLTYAVIVVPGSVALGLGVAMLIESGTH
LRAFYRTIYFLPVMATLIAMAIVWEFMLHPQFGLVNGLIKMVGLAPHPWLQDRGTALYAL
CAIGIWQAVGFNMVLFLAGLMSIPKHLYDAAEIDGAASAWSRFRLVTWPMLGPVTLFVVV
ITGIRSFQVFDTVHVLTKGGPSKSTEVLIHTMYMEGFEFFRSGYAAAVTVVFLCLVLLLT
LVKSRLAAKQVHYA