Protein Info for TX73_000570 in Rhodopseudomonas palustris CGA009

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 45 to 74 (30 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details PF01925: TauE" amino acids 30 to 255 (226 residues), 89.7 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to rpa:RPA0111)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>TX73_000570 sulfite exporter TauE/SafE family protein (Rhodopseudomonas palustris CGA009)
MTTAMHELIAEASASFLSTLPSPMAIVGVLSAVLAAALLRGFTGFGFALAAVPLMGMFMP
PAKAVPVAVLLQLLGGLNDLRRNHRDAHWASLRWLIVGAVIGSPIGALALSVAPAPVARI
VIATITAAAVVVLGRGFAIEKIPSRPVTTAVGMLCGLFNGLAAMPSPPAIVYYMSGPFRA
VAVRASLLVFFLATSIAGFTSIALVGLATVNVLWLAAMALPVMMLGTWIGEQGFRRGTER
LHRRVSIASLGGVALLSAAKGLSELM