Protein Info for TX73_000520 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 6 to 106 (101 residues), 40.2 bits, see alignment E=3.5e-14 PF00528: BPD_transp_1" amino acids 117 to 322 (206 residues), 142.2 bits, see alignment E=1.6e-45

Best Hits

Swiss-Prot: 44% identical to Y3408_BRUSU: Putative peptide permease protein BRA0408/BS1330_II0405 (BRA0408) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to rpt:Rpal_0105)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>TX73_000520 ABC transporter permease (Rhodopseudomonas palustris CGA009)
MALLTHLFGKLANAVALLLAVLVMNFCLIHLAPGDPVQVIAGEMGGASPEVIAALRAKYG
LDHSLLEQMFTYLGKVAHGDFGYSYYFNQPVLGLILQRLPATLYLAAASLVVAVLIGTVL
GVISARRPNGLLSHGVTVLALAGHAAPIFWTGLLLLLLFGSVWPILPVNGMTDVVNPKTG
FAYAADVAKHLVLPSITLGLVFVAQYSRLARVNMIDVLSADYIRTARAKGLPERVVLVKH
ALRNTLIPIVTVVGLQFGNLFAGAVLVETVYSWPGMGRLVFDSILRRDYPTLMGVLFFSA
VMVIAANILTDLVYRLIDPRIRAGAR