Protein Info for TX73_000430 in Rhodopseudomonas palustris CGA009

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 20 to 252 (233 residues), 273.6 bits, E=3.6e-85
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 24 to 251 (228 residues), 256.6 bits, E=8.1e-81
• PF13489: Methyltransf_23
  • amino acids 59 to 233 (175 residues), 31.5 bits, E=4.3e-11
• PF13847: Methyltransf_31
  • amino acids 67 to 177 (111 residues), 60.6 bits, E=4.6e-20
• PF13649: Methyltransf_25
  • amino acids 70 to 165 (96 residues), 66.7 bits, E=7.5e-22
• PF08241: Methyltransf_11
  • amino acids 70 to 170 (101 residues), 66.2 bits, E=1.1e-21
• PF08242: Methyltransf_12
  • amino acids 70 to 167 (98 residues), 43.9 bits, E=9.8e-15

Best Hits

Swiss-Prot: 100% identical to UBIE_RHOPA: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 99% identity to rpx:Rpdx1_0085)

MetaCyc: 55% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Cereibacter sphaeroides)
RXN-9235 [EC: 2.1.1.201]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (5/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of menaquinol-10 biosynthesis (5/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of menaquinol-9 biosynthesis (5/10 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Protein Sequence (253 amino acids)

>TX73_000430 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Rhodopseudomonas palustris CGA009)
MTEPGETTHFGYRDVPLDEKQTLVNDVFHSVAGRYDLMNDLMSGGMHRLWKDVMITTLNP
PRDDTPFRLLDVAGGTGDISFRAAKASGAGFHSTVCDINTDMLEVGRQRAVERNLDDKVD
FVEGNAESLQFDDRSFDAYTIAFGIRNVPRIDLALKEAYRVLKPGSRFLCLEFSSVDVPG
LSKLYDLFSFKVIPEIGRVVTGDADSYQYLVESIRKFPKPYDFAEMMRDAGFARANWQVM
SGGIVALHSGWRL