Protein Info for TX73_000425 in Rhodopseudomonas palustris CGA009

Annotation: 2-polyprenylphenol 6-hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 505 to 522 (18 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 9 to 440 (432 residues), 528.2 bits, see alignment E=6.8e-163 PF03109: ABC1" amino acids 93 to 340 (248 residues), 259.6 bits, see alignment E=2.3e-81

Best Hits

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to rpt:Rpal_0085)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>TX73_000425 2-polyprenylphenol 6-hydroxylase (Rhodopseudomonas palustris CGA009)
MIAALTHVARLGRAAFVFAREGVFGVVDPALIPPAGQVPVRLARLIERRGAKSGARLSRA
LTRLGPAYLKLGQFLATRPDVVGVAMARDLESLQDRLPPFSQDEAEQVIAISLERPVRDL
FVSLSPPVAAASIAQVHRGEIELGGVRKQVAVKVLRPNVSARFRRDLSDFFYVAEKAELY
SAEARRLRLVEVINTMSRSVAMEMDLRLEAAAASEMAENTKDDPDFRVPTVDWDRTSHNV
LTMEWIDGIPLNDHARLKEANVDTVELGRKVIQSFLRHALRDGFFHADMHPGNLFLDRDG
KLVAVDFGIMGRLLPKERRFLAEILLGFITRNYRRVAEVHFEAGYVPPHHSVENFAQAIR
AIGEPIHNRLAEEISMAKLLTLLLEVTGLFDMRTRPELILLQKTMVVVEGVARSFDPKLD
IWKVADPVVREWIQRNLGPIGKVEGALAGAGELGHTLTSLPTIVSRAVTVLNQLEVMTKD
GLVLAPETIAAIGRTERGRTRGRTVALWVIAATFIGVLIALSRMI