Protein Info for TX73_000365 in Rhodopseudomonas palustris CGA009

Annotation: tryptophan synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00262: tryptophan synthase, alpha subunit" amino acids 9 to 254 (246 residues), 261.7 bits, see alignment E=2.3e-82 PF00290: Trp_syntA" amino acids 9 to 252 (244 residues), 312.4 bits, see alignment E=1.7e-97 PF00977: His_biosynth" amino acids 184 to 242 (59 residues), 24.3 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 100% identical to TRPA_RHOPA: Tryptophan synthase alpha chain (trpA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 100% identity to rpa:RPA0070)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>TX73_000365 tryptophan synthase subunit alpha (Rhodopseudomonas palustris CGA009)
MTTRIDTRFGELKQQGRPALVTFVMAGDPDLDTSLQILKVLPAAGADVIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLGLVRDFRATDNATPLVLMGYYNPIYIYGVDAFLADAK
AAGVDGLIIVDLPPEEDEELCLPAMKAGLNFIRLATPTTDEKRLPAVLANTSGFVYYVSI
TGITGSASADASAVGAAVQRIKRHTNLPVCVGFGIRTPDAAQAIAAQANGAVVGSALIDA
LKASLNAEGRATKATVGAVADLVASLAAGVRGAKQAAE