Protein Info for TX73_000260 in Rhodopseudomonas palustris CGA009

Annotation: RNA polymerase factor sigma-54

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 PF00309: Sigma54_AID" amino acids 6 to 50 (45 residues), 64.9 bits, see alignment 6.9e-22 TIGR02395: RNA polymerase sigma-54 factor" amino acids 11 to 525 (515 residues), 442.5 bits, see alignment E=9.1e-137 PF04963: Sigma54_CBD" amino acids 165 to 352 (188 residues), 198.9 bits, see alignment E=9.9e-63 PF04552: Sigma54_DBD" amino acids 367 to 526 (160 residues), 238 bits, see alignment E=6.5e-75

Best Hits

Swiss-Prot: 79% identical to RP55_BRADU: RNA polymerase sigma-54 factor 2 (rpoN2) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 100% identity to rpt:Rpal_0052)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>TX73_000260 RNA polymerase factor sigma-54 (Rhodopseudomonas palustris CGA009)
MALSQRLEFRQTQSLVMTPQLMQAIKLLQLSNLDLAAFVEDEIEKNPLLDRAGDNAEPPV
AGEASAEGAEGGGEFGGSGGEDLGGEGTSDFVDPAGAGAFEPGTEEWMHRDLGSRSDIEQ
TLDTGMENVFPEEPAEAAARAAQDAAPASYTEWGGGASSDEGYNLEAFVAAESSLADHLA
EQLAVAVTTPSQRLIGQYLIDLVDDAGYLPADLGDAAERLGASQAEVEALVQVLQTFDPP
GICARNLSECLAIQLRERDRYDPAMQALVEHLDLLAKRDVASLRKICGVDDEDLVDMIGE
IRHLDPKPGLKFGSSRVQTVVPDVFVRPGPDGGWLVELNSDTLPKVLVNQSYYSELSKTI
RKDGDKSYFSDCLQNATWLVRALDQRARTILKVATEIVRQQDGFFTHGVKHLRPLNLKAV
ADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIASADGGEAHSAEAVRHQIRQLID
SEDPSAILSDDTIVERLREAGIDIARRTVAKYREAMRIPSSVQRRRDKQNMLGTQAGAAS
RSRDTAPA