Protein Info for TX73_000050 in Rhodopseudomonas palustris CGA009

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF13404: HTH_AsnC-type" amino acids 15 to 56 (42 residues), 66.8 bits, see alignment E=2.2e-22 PF13412: HTH_24" amino acids 15 to 61 (47 residues), 65.9 bits, see alignment E=3.8e-22 PF08279: HTH_11" amino acids 20 to 63 (44 residues), 23.1 bits, see alignment E=1.1e-08 PF01037: AsnC_trans_reg" amino acids 81 to 153 (73 residues), 76.6 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 55% identical to DECR_ECO57: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O157:H7

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 100% identity to rpa:RPA0010)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>TX73_000050 Lrp/AsnC family transcriptional regulator (Rhodopseudomonas palustris CGA009)
MTDIDSVVAESNRRLDAIDRKILTVLQQDASLSVAEIGDRVGLSSTPCWKRIQRLEADGV
IIKRVALVDQDKIGLGLSVFVSIESGDHSDAWLKTFADAVSAMPEVIEFYRMAGDVDYML
RVVVADMRAYDQFYKKLIGTVPLKNVTSRFAMEKIKSVTALPVPPMPVS