Protein Info for TX73_000025 in Rhodopseudomonas palustris CGA009

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 16 to 153 (138 residues), 184.9 bits, E=1.3e-58
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 23 to 366 (344 residues), 386.5 bits, E=7.6e-120
• PF00903: Glyoxalase
  • amino acids 170 to 283 (114 residues), 41.8 bits, E=2.1e-14

Best Hits

Swiss-Prot: 54% identical to HPPD_PSEUJ: 4-hydroxyphenylpyruvate dioxygenase (hpd) from Pseudomonas sp. (strain P.J. 874)

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 100% identity to rpa:RPA0005)

MetaCyc: 54% identical to 4-hydroxyphenylpyruvate dioxygenase subunit (Pseudomonas sp. P.J. 874)
4-hydroxyphenylpyruvate dioxygenase. [EC: 1.13.11.27]

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• superpathway of plastoquinol biosynthesis (3/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Protein Sequence (372 amino acids)

>TX73_000025 4-hydroxyphenylpyruvate dioxygenase (Rhodopseudomonas palustris CGA009)
MGPFPHDAQPATISADNPMGTDGFEFVEFAHPDPAQLHSLFKLMGFSLVAKHRTKAISVY
RQGDVNYLVNEQPGTHGTDFVTAHGPCAPSMAFRVVDAKQAYERAISLGAEPAGVTAAQA
TLDVPAIKGIGGSLLYFVDRYGAKGSAYDAEFDWVGSRDARPAGAGLYYIDHLTHNVHRG
RMDVWTGFYAKLFNFRQIRFFDIEGRASGLFSRALTSPDGKIRIPINEDAGDSGQIEEYL
SLYRGEGIQHIACGCRDIYSTVEGLRAAGLPFMPSPPETYFERVDARLPKHGEDIARLQR
NGILIDGEGVVDGGQTKVLLQIFSANAIGPIFFEFIQRKGDDGFGEGNFKALFESIEEDQ
IRRGVLKAERAA