Protein Info for Synpcc7942_B2646 in Synechococcus elongatus PCC 7942

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details PF00512: HisKA" amino acids 220 to 278 (59 residues), 54.4 bits, see alignment E=1.1e-18 PF02518: HATPase_c" amino acids 326 to 435 (110 residues), 108.1 bits, see alignment E=3.5e-35

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to syf:Synpcc7942_B2646)

Predicted SEED Role

"Two-component sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P72560 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Synpcc7942_B2646 two-component sensor histidine kinase (Synechococcus elongatus PCC 7942)
MALAIAFDRLRPLQRSRWRLTLLYAGTMGGLLLLCAIAVDVLLTRSYRFDLDHRLESVAG
VLQASLEPQLSRSQSLASETQQWLRQLCPPRHACPTASHGKVTDPAAQGGYLQVLSTDGQ
TVMTLGVGPVSSLQPQAGWQTLSREQGHFRQLVLPLRDRQQQPWGLLVLGRSLVELDQQV
QTWRWGLAIALPLLLAIISWLSWWLAGQALQPVLQSYRQMQQFTADAAHELRTPLAALQA
TVESHQPSEAAQVWPVLERQMTRLQLLIEDLLLLSRLDRDQPVLGDRCCLNDLVEEAAAT
FMPLANQAQIALQIEAVGTGLLVSGNSAQLYRVLANLLGNAIAHTPAGGKIQLALSVVDR
WGVLTVRDNGCGIPTADQARIFERFVRLDSARNRQQGGAGLGLAIVQAIVRAHRGQVQVT
SAIGQGSCFRVQLPLLAT