Protein Info for Synpcc7942_B2630 in Synechococcus elongatus PCC 7942

Name: srpM
Annotation: sulfonate ABC transporter, permease protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 185 to 212 (28 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 264 (172 residues), 73.9 bits, see alignment E=7.2e-25

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to syf:Synpcc7942_B2630)

Predicted SEED Role

"ABC transporter permease protein with unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R6V0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Synpcc7942_B2630 sulfonate ABC transporter, permease protein, putative (Synechococcus elongatus PCC 7942)
MTISLRSRHRWFSALQQLAQSIPYPLRGLLLGLLLWSTLTSAWINPDPVWQAFAPESAIA
ALGKLLFNGTLWPHIGASLQRVAVGLLAAIAVGVPVGLLFGLVPMIERSASGALQFIRMI
SPLSWMPIAVMAFGIGDLPVYFLLAIAAVWPILLSTSSGTAAVNHKLLLLARSLCATRSE
TIRRIVIPAIVPQILVGVRLAIGTIWIVLVPAEMLGVSSGLGYFILDTRDRIAYNELTAV
LLAIGIIGCALDWSLQFLQKYWQPSR